PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_03826.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 294aa    MW: 32986.2 Da    PI: 8.2355
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_03826.1_g00003.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.23.3e-172471148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             rg W++eEd +l+++++ +G ++W+++++  g+ R++k+c++rw +yl
  Rsa1.0_03826.1_g00003.1 24 RGLWSPEEDAKLLRYITTHGHPSWSSVPKLAGLQRCGKSCRLRWINYL 71
                             788*******************************************97 PP

2Myb_DNA-binding55.41.4e-1777120146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              rg++T+eE++ ++d+++ lG++ W+ Ia++++ gRt++++k++w++
  Rsa1.0_03826.1_g00003.1  77 RGSFTAEEEQTIIDVHRILGNK-WAQIAKHLP-GRTDNEVKNFWNS 120
                              89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.9E-251674IPR009057Homeodomain-like
PROSITE profilePS5129417.1281971IPR017930Myb domain
SuperFamilySSF466894.49E-2922118IPR009057Homeodomain-like
SMARTSM007174.6E-122373IPR001005SANT/Myb domain
PfamPF002496.3E-152471IPR001005SANT/Myb domain
CDDcd001671.55E-102771No hitNo description
PROSITE profilePS5129426.60372126IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-2675126IPR009057Homeodomain-like
SMARTSM007176.5E-1676124IPR001005SANT/Myb domain
PfamPF002495.1E-1677120IPR001005SANT/Myb domain
CDDcd001675.52E-1279119No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MSEKWEMKRD EMGHRCCGKH KVKRGLWSPE EDAKLLRYIT THGHPSWSSV PKLAGLQRCG  60
KSCRLRWINY LRPDLKRGSF TAEEEQTIID VHRILGNKWA QIAKHLPGRT DNEVKNFWNS  120
CIKKKLLSQG LDPSTHNLMP SHKRSASSSS GNNPKQSKTK SIMANPTFDQ STTAFSITNV  180
NPYTSNKPNR VKSPNQAPIP SQPVIPIDHT MSSLLNDENG IPNWSTVDGM ATIPEEAPMF  240
SSEKAVTGVE DDDINMDILF NTPSSSTFDP DFASIFSSAM SMDFNPMDDL GWSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-30241267108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00350DAPTransfer from AT3G12720Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893350.0AC189335.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB039A19, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013585064.10.0PREDICTED: transcription repressor MYB6-like
TrEMBLA0A078HWQ40.0A0A078HWQ4_BRANA; BnaC05g40480D protein
STRINGBra034738.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79552539
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12720.11e-176myb domain protein 67